| IED ID | IndEnz0002003642 |
| Enzyme Type ID | protease003642 |
| Protein Name |
Virion membrane protein A17 precursor 23 kDa late protein Cleaved into: Mature 21 kDa protein A17 |
| Gene Name | A17L |
| Organism | Vaccinia virus (strain Copenhagen) (VACV) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Copenhagen) (VACV) |
| Enzyme Sequence | MSYLRYYNMLDDFSAGAGVLDKDLFTEEQQQSFMPKDGGMMQNDYGGMNDYLGIFKNNDVRTLLGLILFVLALYSPPLISILMIFISSFLLPLTSLVITYCLVTQMYRGGNGNTVGMSIVCIVAAVIIMAINVFTNSQIFNIISYIILFILFFAYVMNIERQDYRRSINVTIPEQYTCNKPYTAGNKVDVDIPTFNSLNTDDY |
| Enzyme Length | 203 |
| Uniprot Accession Number | P68592 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Envelope protein which participates in virus morphogenesis. Needed for an early step in viral crescent membrane formation by interacting with D13 scaffold protein. Its interaction with D13 scaffold protein leads to the formation of rigid, crescent-shaped membranes that assemble around the cytoplasmic virus factory. Membrane anchor for the protein A27. A17-A27 virus envelope protein might be involved in fusion or attachment, and can further associate to A26 (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Disulfide bond (2); Modified residue (1); Propeptide (2); Region (1); Site (2); Topological domain (3); Transmembrane (2) |
| Keywords | Disulfide bond;Membrane;Phosphoprotein;Reference proteome;Transmembrane;Transmembrane helix;Viral envelope protein;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Note=The 23 kDa precursor is associated with immature virions (IV) and the final 21 kDa form is present in mature virions (MV). {ECO:0000250}. |
| Modified Residue | MOD_RES 203; /note=Phosphotyrosine; /evidence=ECO:0000250 |
| Post Translational Modification | PTM: The 23 kDa precursor is cleaved into a final 21 kDa form by the I7 protease during virus maturation. {ECO:0000250}.; PTM: Phosphorylated on tyrosine and threonine. Its phosphorylation state is regulated by the F10 kinase and the H1 phosphatase (By similarity). Phosphorylation by F10 kinase seems to be required to form the membranes associated with IV (By similarity). {ECO:0000250}.; PTM: Not glycosylated. {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 22,999 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |