IED ID | IndEnz0002003652 |
Enzyme Type ID | protease003652 |
Protein Name |
Aspartic protease inhibitor 2 CathIhn Cathepsin D inhibitor CathDinh |
Gene Name | |
Organism | Solanum tuberosum (Potato) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) |
Enzyme Sequence | MMKCLFLLCLCLLPIVVFSSTFTSQNLIDLPSESPLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDGPCPDGVFRYNSDVGPSGTFVRFIPLSGGIFEDQLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADSSYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENPLDVLFQEV |
Enzyme Length | 220 |
Uniprot Accession Number | Q43646 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Inhibitor of cathepsin D (aspartic protease). May also inhibit trypsin and chymotrypsin (serine proteases). Protects the plant by inhibiting proteases of invading organisms. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (2); Glycosylation (1); Motif (1); Propeptide (1); Signal peptide (1); Site (2) |
Keywords | Aspartic protease inhibitor;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Serine protease inhibitor;Signal;Vacuole |
Interact With | |
Induction | INDUCTION: Not induced by abscisic acid, jasmonic acid and wounding. |
Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000250 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | MOTIF 26..31; /note=Vacuolar targeting signal; /evidence=ECO:0000250 |
Gene Encoded By | |
Mass | 24,199 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |