| IED ID | IndEnz0002003702 |
| Enzyme Type ID | protease003702 |
| Protein Name |
Leukocyte cell-derived chemotaxin 1 Chondromodulin Small cartilage-derived glycoprotein SCGP Cleaved into: Chondrosurfactant protein CH-SP ; Chondromodulin-1 Chondromodulin-I ChM-I |
| Gene Name | CNMD CHMI LECT1 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MTENSDKVPIALVGPDDVEFCSPPAYAAVTVKPSSPARLLKVGAVVLISGAVLLLLGAIGAFYFWKGSDNHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAVEVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGTMTKQSISSELEGKIMPVKYEENSLIWVAGDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERRELVRKIVTTTTTRRLRSGPQGTPAPGRPNNGTRPSVQEDAEPFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYHPWPYNYQGCRSACRVIMPCSWWVARILGMV |
| Enzyme Length | 335 |
| Uniprot Accession Number | P17404 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Compositional bias (1); Disulfide bond (5); Domain (1); Glycosylation (3); Natural variant (2); Propeptide (1); Region (1); Sequence conflict (1); Transmembrane (1) |
| Keywords | Chondrogenesis;Cleavage on pair of basic residues;Developmental protein;Differentiation;Direct protein sequencing;Disulfide bond;Extracellular matrix;Glycoprotein;Membrane;Reference proteome;Secreted;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Chondromodulin-1]: Secreted, extracellular space, extracellular matrix. Note=Accumulated in the inter-territorial matrix of cartilage.; SUBCELLULAR LOCATION: [Chondrosurfactant protein]: Endomembrane system {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: After cleavage, the post-translationally modified ChM-I is secreted as a glycoprotein. {ECO:0000269|PubMed:11323410}.; PTM: Two other smaller nonglycosylated chondromodulin forms (9 kDa and 7 kDa) are found either in developing articular cartilage or in chondrocytes. The 9 kDa form could be processed by an extracellular matrix-associated protease as a metalloproteinase and the 7 kDa form could be processed intracellularly. {ECO:0000269|PubMed:11323410}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 37,164 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |