| IED ID | IndEnz0002003717 |
| Enzyme Type ID | protease003717 |
| Protein Name |
Trypsin inhibitor LTI LlTI Kunitz-type trypsin inhibitor LlTI Cleaved into: Trypsin inhibitor alpha chain; Trypsin inhibitor beta chain |
| Gene Name | |
| Organism | Leucaena leucocephala (White popinac) (Leucaena glauca) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Caesalpinioideae mimosoid clade Mimoseae Leucaena Leucaena leucocephala (White popinac) (Leucaena glauca) |
| Enzyme Sequence | QVLVDLDGDPLYNGMSYYILPVARGKGGGLELARTGSESCPRTVVQTRSETSRGLPARLASPYRILIGSNIPLTIEFQPQKPYSCHGHSSRSLQWKVEKTQMVKIASSDEEQRLFGPFQIQPYRNHYKLVYCESESRNHHDDCRDLGISIDDQQNRLLVVKNGDPLVVQFAKANRGGDD |
| Enzyme Length | 179 |
| Uniprot Accession Number | P83036 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin, plasmin, human plasma kallikrein, chymotrypsin and factor XIIa activity. {ECO:0000269|PubMed:10708849}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Disulfide bond (2); Modified residue (1); Natural variant (2); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Pyrrolidone carboxylic acid;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 1; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:10708849 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,104 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |