| IED ID | IndEnz0002003719 |
| Enzyme Type ID | protease003719 |
| Protein Name |
Internal protein II IpII |
| Gene Name | ipi2 |
| Organism | Enterobacteria phage T4 (Bacteriophage T4) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Tevenvirinae Tequatrovirus Enterobacteria phage T4 (Bacteriophage T4) |
| Enzyme Sequence | MKTYQEFIAEARVGAGKLEAAVNKKAHSFHDLPDKDRKKLVSLYIDRERILALPGANEGKQAKPLNAVEKKIDNFASKFGMSMDDLQQAAIEAAKAIKDK |
| Enzyme Length | 100 |
| Uniprot Accession Number | P03719 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Internal protein II, which has a histone-like character, binds weakly to other components of the assembly core during an early stage of bacteriophage head morphogenesis. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Propeptide (1); Sequence conflict (6); Site (1) |
| Keywords | Direct protein sequencing;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,086 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |