IED ID | IndEnz0002003720 |
Enzyme Type ID | protease003720 |
Protein Name |
Proteinase inhibitor I-A PI-IA Inhibitor of microbial serine proteinases minor isoform |
Gene Name | TIMPB |
Organism | Nicotiana tabacum (Common tobacco) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
Enzyme Sequence | MVKFAHVVAFLLLASLIQPLTARDLEINVLQLDVSQSGCPGVTKERWPELLGTPAKFAMQIIQKENPKLTNVQTILNGGPVTEDLRCNRVRLFVNVLDFIVQTPQIG |
Enzyme Length | 107 |
Uniprot Accession Number | Q03198 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Propeptide (1); Signal peptide (1); Site (1) |
Keywords | Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
Interact With | |
Induction | INDUCTION: By tobacco mosaic virus infection, wounding, UV light, salicylic acid and ethylene. |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 11,880 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |