| IED ID | IndEnz0002003721 |
| Enzyme Type ID | protease003721 |
| Protein Name |
Proteinase inhibitor I-B PI-IB Inhibitor of microbial serine proteinases major isoform |
| Gene Name | TIMPA |
| Organism | Nicotiana tabacum (Common tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
| Enzyme Sequence | MVKFAHVVAFLLLASLFQPLTARDLEINVLQLDVSQSGCPGVTKERWPELLGTPAKFAMQIIQKENPKLTNVQTVLNGTPVTEDLRCNRVRLFVNVLDFVVQTPQVG |
| Enzyme Length | 107 |
| Uniprot Accession Number | Q03199 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Propeptide (1); Signal peptide (1); Site (1) |
| Keywords | Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | INDUCTION: By tobacco mosaic virus infection, wounding, UV light, salicylic acid and ethylene. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,916 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |