| IED ID | IndEnz0002003723 |
| Enzyme Type ID | protease003723 |
| Protein Name |
Trypsin inhibitor FtTI |
| Gene Name | |
| Organism | Fagopyrum tataricum (Tartarian buckwheat) (Polygonum tataricum) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae Caryophyllales Polygonaceae Polygonoideae Fagopyreae Fagopyrum Fagopyrum tataricum (Tartarian buckwheat) (Polygonum tataricum) |
| Enzyme Sequence | LIYAKVECLTTGVRTYVGKQSWPELVGTKGKTAAATIDKENTHVTAVLCPPLTTLAACRTFDFRCDRVRVLINRIGGVVTKTPTVG |
| Enzyme Length | 86 |
| Uniprot Accession Number | P86971 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor which is active against trypsin. Displays strong antifungal activity against a number of phytopathogenic fungi including M.melonis, A.cucumerina, A.solani, C.glaeosporioides and P.capsici. {ECO:0000269|PubMed:21544554}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Active between 10 and 60 degrees Celsius. 84% activity retained when heated for 30 minutes at 80 degrees Celsius. Incubation at temperatures above 80 degrees Celsius rapidly decreases inhibitory activity. {ECO:0000269|PubMed:21544554}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.0 at 37 degrees Celsius. Maintains over 90% of its inhibitory activity from pH 3 to 10. {ECO:0000269|PubMed:21544554}; |
| Pathway | |
| nucleotide Binding | |
| Features | Disulfide bond (2); Peptide (1); Site (1) |
| Keywords | Antimicrobial;Direct protein sequencing;Disulfide bond;Fungicide;Plant defense;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,293 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |