| IED ID |
IndEnz0002003751 |
| Enzyme Type ID |
protease003751 |
| Protein Name |
Adapter protein MecA
|
| Gene Name |
mecA OB1811 |
| Organism |
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Oceanobacillus
Oceanobacillus iheyensis
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
|
| Enzyme Sequence |
MRIERVSTDQFKIFLTFDDLIERGFTREDLWHDASNVRSLFSDMMYEASSELGIELEGMLLVQVHLMQAQGMHIFVTQQYEDNSEDEDYIEMKVTLDESKELIFSFMDFEDIISVTSYLDPMGLENIRLYYMEDRYYMILDHIELSRVDKEDIIGVMSEYANPSIVTSHRIEEYGKLIMEENTVQQIKRFFY |
| Enzyme Length |
192 |
| Uniprot Accession Number |
Q8EQ97 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. Acts negatively in the development of competence by binding ComK and recruiting it to the ClpCP protease. When overexpressed, inhibits sporulation. Also involved in Spx degradation by ClpC. {ECO:0000255|HAMAP-Rule:MF_01124}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
Competence;Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
22,906 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|