| IED ID | IndEnz0002003775 |
| Enzyme Type ID | protease003775 |
| Protein Name |
Non-specific lipid transfer protein-like 1 OsLTPL1 |
| Gene Name | LTPL1 Os03g0385400 LOC_Os03g26820 B1246D11.7 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MAVAARAAAVACLLVVGLAAVAGVDGATASSPAPAPAVDCTAEALKLADCLDYVTPGKTAPSRPSKLCCGEVKGALKDSAAVGCLCAAFTSKTLPLPINITRALHLPAACGADASAFSKCLAPAPSPSVAPGTSSGSGGAAAAPAKGAAAARSPMASTTAVLVVAAAVAAPLLAFFHF |
| Enzyme Length | 178 |
| Uniprot Accession Number | Q6ASY2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Glycosylation (1); Lipidation (1); Propeptide (1); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;GPI-anchor;Glycoprotein;Hydrolase;Hydroxylation;Lipid-binding;Lipoprotein;Membrane;Protease;Proteoglycan;Reference proteome;Signal;Vacuole |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole, aleurone grain membrane {ECO:0000305}; Lipid-anchor, GPI-anchor {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: O-glycosylated on hydroxyprolines; noncontiguous hydroxylproline residues are glycosylated with arabinogalactan. {ECO:0000305}. |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000269|PubMed:15653800 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,899 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |