| IED ID | IndEnz0002003782 |
| Enzyme Type ID | protease003782 |
| Protein Name |
Dermcidin EC 3.4.-.- Preproteolysin Cleaved into: Survival-promoting peptide; DCD-1 |
| Gene Name | DCD AIDD DSEP |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL |
| Enzyme Length | 110 |
| Uniprot Accession Number | P81605 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues (PubMed:17448443). {ECO:0000269|PubMed:17448443}.; FUNCTION: Survival-promoting peptide promotes survival of neurons and displays phosphatase activity. It may bind IgG. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (3); Chain (1); Helix (1); Modified residue (1); Peptide (2); Propeptide (2); Region (1); Signal peptide (1) |
| Keywords | 3D-structure;Acetylation;Alternative splicing;Antibiotic;Antimicrobial;Direct protein sequencing;Fungicide;Hydrolase;Manganese;Protease;Reference proteome;Secreted;Signal |
| Interact With | Q92624; Q12797-6 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 68; /note=N6-acetyllysine; /evidence=ECO:0007744|PubMed:19608861 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence="ECO:0000269|PubMed:15340161, ECO:0000269|PubMed:25946035, ECO:0000269|PubMed:9736629" |
| Structure 3D | NMR spectroscopy (2); X-ray crystallography (2) |
| Cross Reference PDB | 2KSG; 2NDK; 2YMK; 6SHK; |
| Mapped Pubmed ID | 15174051; 15175163; 15670776; 15944307; 16142329; 16354654; 16374474; 16685272; 17353931; 17373842; 17620599; 17626247; 18058718; 18372903; 18403914; 18594538; 18599487; 18714373; 19020323; 19156129; 19670153; 19703016; 19720844; 19833888; 20562859; 20571754; 20809104; 20837461; 20889853; 21397687; 21565611; 21642987; 21988832; 22262861; 22455996; 22588119; 23426625; 24189400; 24562771; 24969620; 25055737; 25416956; 25596890; 25604459; 25673161; 25879571; 26212323; 26718508; 26944449; 27392853; 27650261; 29066724; 30226544; 30463107; 30734678; 31115649; 33981001; |
| Motif | |
| Gene Encoded By | |
| Mass | 11,284 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |