| IED ID | IndEnz0002003788 |
| Enzyme Type ID | protease003788 |
| Protein Name |
Cystatin WCPI-3 Fragments |
| Gene Name | |
| Organism | Wisteria floribunda (Japanese wisteria) (Glycine floribunda) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Wisterieae Wisteria Wisteria floribunda (Japanese wisteria) (Glycine floribunda) |
| Enzyme Sequence | YGNTGGYTPVPDIDDIHVVEIANYAVTEYNKKSGVVAGVNYRFVLK |
| Enzyme Length | 46 |
| Uniprot Accession Number | P19864 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of papain. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Motif (1); Non-adjacent residues (1); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Protease inhibitor;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 35..38; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 5,048 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |