| IED ID | IndEnz0002003801 |
| Enzyme Type ID | protease003801 |
| Protein Name |
Gag polyprotein Pr55Gag Cleaved into: Matrix protein p17 MA ; Capsid protein p24 CA ; Spacer peptide p2; Nucleocapsid protein p7 NC ; Spacer peptide p1; p6-gag |
| Gene Name | gag |
| Organism | Simian immunodeficiency virus agm.vervet (isolate AGM155) (SIV-agm.ver) (Simian immunodeficiency virus African green monkey vervet) |
| Taxonomic Lineage | Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Lentivirus Simian immunodeficiency virus (SIV) Simian immunodeficiency virus - agm Simian immunodeficiency virus - agm.ver Simian immunodeficiency virus agm.vervet (isolate AGM155) (SIV-agm.ver) (Simian immunodeficiency virus African green monkey vervet) |
| Enzyme Sequence | MGAATSALNRRQLDEFEHIRLRPNGKKKYQIKHLIWAGKKMDRFGLHEKLLETEEGCKKIIEVLSPLEPTGSEGMKSLYNLVCVLLCVHQEKKVKDTEEALAIVRQCCHLVDKEKTAVTPPGGQQKNNTGGTATPGGSQNFPAQQQGNAWVHVPLSPRTLNAWVKAVEEKKFGAEIVPMFQALSEGCTPYDINQMLNVLGDHQGALQIVKEIINEEAAQWDVTHPPPAGPLPAGQLRDPGGSDIAGTTSTVQEQLEWIYTANPRVDVGAIYRRWIILGLQKCVKMYNPVSVLDIRQGPKEPFKDYVDRFYKAIRAEQASGEVKQWMTESLLIQNANPDCKVILKGLGMHPTLEEMLTACQGVGGPSYKAKVMAEMMQNLQSQNMVQQGGGRGRPRPPPKCYNCGKFGHMQRQCPEPRKIKCLKCGKPGHLAKDCRGQVNFLGYGRWMGTKPRNFPAATLGAEPSAPPPPNNSTPYDPAKKLLQQYAEKGKQMRNQNRNPPANNPDWNEGYSLNSLFGEDQ |
| Enzyme Length | 520 |
| Uniprot Accession Number | P27972 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Matrix protein p17 targets Gag and Gag-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the preintegration complex. Implicated in the release from host cell mediated by Vpu (By similarity). {ECO:0000250}.; FUNCTION: Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex. {ECO:0000250}.; FUNCTION: Nucleocapsid protein p7 encapsulates and protects viral dimeric unspliced (genomic) RNA. Binds these RNAs through its zinc fingers (By similarity). {ECO:0000250}.; FUNCTION: p6-gag plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (5); Compositional bias (2); Initiator methionine (1); Lipidation (1); Motif (3); Peptide (2); Region (2); Site (1); Zinc finger (2) |
| Keywords | Capsid protein;Host cytoplasm;Host nucleus;Host-virus interaction;Lipoprotein;Metal-binding;Myristate;Phosphoprotein;RNA-binding;Repeat;Ribosomal frameshifting;Viral budding;Viral budding via the host ESCRT complexes;Viral nucleoprotein;Viral release from host cell;Virion;Zinc;Zinc-finger |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Matrix protein p17]: Virion {ECO:0000305}. Host nucleus {ECO:0000250}. Host cytoplasm {ECO:0000250}. Note=Following virus entry, the nuclear localization signal (NLS) of the matrix protein participates with Vpr to the nuclear localization of the viral genome. During virus production, the nuclear export activity of the matrix protein counteracts the NLS to maintain the Gag and Gag-Pol polyproteins in the cytoplasm, thereby directing unspliced RNA to the plasma membrane (By similarity). {ECO:0000250}.; SUBCELLULAR LOCATION: [Capsid protein p24]: Virion {ECO:0000305}.; SUBCELLULAR LOCATION: [Nucleocapsid protein p7]: Virion {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | PTM: Capsid protein p24 is phosphorylated. {ECO:0000250}.; PTM: Specific enzymatic cleavages by the viral protease yield mature proteins. The polyprotein is cleaved during and after budding, this process is termed maturation (By similarity). {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 16..22; /note=Nuclear export signal; /evidence=ECO:0000250; MOTIF 26..32; /note=Nuclear localization signal; /evidence=ECO:0000250; MOTIF 463..466; /note=PTAP/PSAP motif |
| Gene Encoded By | |
| Mass | 57,735 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |