IED ID | IndEnz0002003812 |
Enzyme Type ID | protease003812 |
Protein Name |
Alpha-amylase/trypsin inhibitor CM1 Chloroform/methanol-soluble protein CM1 |
Gene Name | |
Organism | Triticum aestivum (Wheat) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Triticinae Triticum Triticum aestivum (Wheat) |
Enzyme Sequence | MASKSSISPLLLATVLVSVFAAATATGPYCYAGMGLPINPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQHCRCEAVRYFIGRRSDPNSSVLKDLPGCPREPQRDFAKVLVTSGHCNVMTVHNAPYCLGLDI |
Enzyme Length | 145 |
Uniprot Accession Number | P16850 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Alpha-amylase/trypsin inhibitor. It could be involved in insect defense mechanisms. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Signal peptide (1) |
Keywords | Alpha-amylase inhibitor;Direct protein sequencing;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000269|Ref.2 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 15,517 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |