| IED ID | IndEnz0002003816 |
| Enzyme Type ID | protease003816 |
| Protein Name |
Glutamyl endopeptidase 2 EC 3.4.21.82 GLUSGP Glutamic acid-specific protease Glutamyl endopeptidase II SGPE Serine protease E Streptogrisin-E |
| Gene Name | sprE |
| Organism | Streptomyces griseus |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces griseus group Streptomyces griseus subgroup Streptomyces griseus |
| Enzyme Sequence | VLGGGAIYGGGSRCSAAFNVTKGGARYFVTAGHCTNISANWSASSGGSVVGVREGTSFPTNDYGIVRYTDGSSPAGTVDLYNGSTQDISSAANAVVGQAIKKSGSTTKVTSGTVTAVNVTVNYGDGPVYNMGRTTACSAGGDSGGAHFAGSVALGIHSGSSGCSGTAGSAIHQPVTKALSAYGVTVYL |
| Enzyme Length | 188 |
| Uniprot Accession Number | Q07006 |
| Absorption | |
| Active Site | ACT_SITE 33; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 62; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 143; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: -Glu-|-Xaa- >> -Asp-|-Xaa-. Preference for Pro or Leu at P2 and Phe at P3. Cleavage of -Glu-|-Asp- and -Glu-|-Pro- bonds is slow.; EC=3.4.21.82; |
| DNA Binding | |
| EC Number | 3.4.21.82 |
| Enzyme Function | FUNCTION: Preferentially cleaves peptide bonds on the carboxyl-terminal side of glutamate. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (17); Chain (1); Disulfide bond (2); Helix (2); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Hydrolase;Protease;Serine protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1HPG; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,337 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |