| IED ID | IndEnz0002003925 |
| Enzyme Type ID | protease003925 |
| Protein Name |
Probable archaeosortase D EC 3.4.22.- |
| Gene Name | artD MJ1469.1 |
| Organism | Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) |
| Taxonomic Lineage | cellular organisms Archaea Euryarchaeota Methanomada group Methanococci Methanococcales Methanocaldococcaceae Methanocaldococcus Methanocaldococcus jannaschii Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) |
| Enzyme Sequence | MGNKNAIYILRFLIYFFIFYYILKMLEGNIMDLLTITLSKLLNLKFYKNEIIVGKNIIEISSPCTCSLEMALFLGYIFGTPDVPIKYKISYSVFGLSIITISNILRIILIINYSNMINYNVVHDVISFIIFPIALFLNWFWIYLLKMKKIIMFK |
| Enzyme Length | 154 |
| Uniprot Accession Number | P81329 |
| Absorption | |
| Active Site | ACT_SITE 64; /note=Acyl-thioester intermediate; /evidence=ECO:0000250|UniProtKB:D4GUZ4; ACT_SITE 106; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:D4GUZ4 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Transpeptidase that recognizes and modifies its substrate by proteolytic cleavage of a sorting signal. Following cleavage, a covalent intermediate is formed via a thioester bond between the archaeosortase and its substrate, which is then transferred and covalently attached to the cell membrane. {ECO:0000250|UniProtKB:D4GUZ4}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Transmembrane (4) |
| Keywords | Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,128 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |