| IED ID |
IndEnz0002003946 |
| Enzyme Type ID |
protease003946 |
| Protein Name |
Conserved virulence factor B
|
| Gene Name |
cvfB SAOUHSC_01391 |
| Organism |
Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Staphylococcaceae
Staphylococcus
Staphylococcus aureus
Staphylococcus aureus (strain NCTC 8325 / PS 47)
|
| Enzyme Sequence |
MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPNRSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPGDYLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSESGYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEYDGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKIALTKKGWSRMDSKE |
| Enzyme Length |
300 |
| Uniprot Accession Number |
Q2FYP3 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Contributes to the expression of virulence factors and to pathogenicity via both agr-dependent and agr-independent pathways. Involved in the production of hemolysin, DNase, protease and protein A. Contributes to virulence in silkworm-infection model and murine model of systemic infection. {ECO:0000269|PubMed:17283102}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
Reference proteome;Virulence |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
34,199 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|