IED ID | IndEnz0002003962 |
Enzyme Type ID | protease003962 |
Protein Name |
Gag polyprotein Core polyprotein Cleaved into: Matrix protein p15 MA ; RNA-binding phosphoprotein p12 pp12 |
Gene Name | gag |
Organism | Friend spleen focus-forming virus (isolate 502) (FSFFV) |
Taxonomic Lineage | Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Gammaretrovirus unclassified Gammaretrovirus Spleen focus-forming virus Friend spleen focus-forming virus (FSFFV) Friend spleen focus-forming virus (isolate 502) (FSFFV) |
Enzyme Sequence | MGQTVTTPLSLTLEHWEDVQRTASNQSVDVKKRRWVTFCSAEWPTFGVGWPQDGTFNLDIILQVKSKVFSPGPHGHPDQVPYIVTWEAIAYEPPPWVKPFVSPKLSPSPTAPILPSGPSTQPPPRSALYPALTPSIKPGPSPIMADLSLTFSQKTLRRTEDRDRPPLTEMATEKRPPPLLRFLPPLP |
Enzyme Length | 187 |
Uniprot Accession Number | P03331 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Gag polyprotein plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably link the viral protein to the host ESCRT pathway and facilitate release (By similarity). {ECO:0000250}.; FUNCTION: Matrix protein p15 targets Gag and gag-pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the preintegration complex (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (3); Compositional bias (2); Initiator methionine (1); Lipidation (1); Motif (2); Region (1); Site (1) |
Keywords | Host cell membrane;Host membrane;Host-virus interaction;Lipoprotein;Membrane;Myristate;RNA-binding;Viral budding;Viral budding via the host ESCRT complexes;Viral matrix protein;Viral release from host cell;Virion |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: [Gag polyprotein]: Virion {ECO:0000250}. Host cell membrane {ECO:0000305}; Lipid-anchor {ECO:0000305}.; SUBCELLULAR LOCATION: [Matrix protein p15]: Virion {ECO:0000305}. |
Modified Residue | |
Post Translational Modification | PTM: Specific enzymatic cleavages by the viral protease yield mature proteins. The protease is released by autocatalytic cleavage. The polyprotein is cleaved during and after budding, this process is termed maturation (By similarity). {ECO:0000250}. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | MOTIF 109..112; /note=PTAP/PSAP motif; MOTIF 128..132; /note=LYPX(n)L motif |
Gene Encoded By | |
Mass | 20,804 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |