| IED ID | IndEnz0002003969 |
| Enzyme Type ID | protease003969 |
| Protein Name |
Rhomboid protease GlpG EC 3.4.21.105 Intramembrane serine protease |
| Gene Name | glpG YPO0121 y3898 YP_0123 |
| Organism | Yersinia pestis |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Yersinia Yersinia pseudotuberculosis complex Yersinia pestis |
| Enzyme Sequence | MTRVIVISNLRLAQAFVDYMATHHVALEIRPDAQGVEIWLADDEQLSAVQHELEQFLLDPLNPRYQAASWQAGNVNSNLPYQRFSYLQTLRSQAGPLTLSVMVLCIAIYILMLITGDMAVMSWLAWPYNSSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLGGQMEKRLGTSKLLVLTIVSAVFSGWGQSLFSGANFGGLSGVVYALMGYVWLTGERAPERGISLPRGLMAFSVLWLIAGYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSARTVQ |
| Enzyme Length | 278 |
| Uniprot Accession Number | Q7CFX8 |
| Absorption | |
| Active Site | ACT_SITE 202; /note=Nucleophile; /evidence=ECO:0000255|HAMAP-Rule:MF_01594; ACT_SITE 255; /evidence=ECO:0000255|HAMAP-Rule:MF_01594 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleaves type-1 transmembrane domains using a catalytic dyad composed of serine and histidine that are contributed by different transmembrane domains.; EC=3.4.21.105; Evidence={ECO:0000255|HAMAP-Rule:MF_01594}; |
| DNA Binding | |
| EC Number | 3.4.21.105 |
| Enzyme Function | FUNCTION: Rhomboid-type serine protease that catalyzes intramembrane proteolysis. {ECO:0000255|HAMAP-Rule:MF_01594}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Transmembrane (6) |
| Keywords | Cell inner membrane;Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Serine protease;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000255|HAMAP-Rule:MF_01594}; Multi-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_01594}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,305 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |