Detail Information for IndEnz0002003979
IED ID IndEnz0002003979
Enzyme Type ID protease003979
Protein Name Glycinin G3
Glycinin 11S G3
Glycinin A1bB2
allergen Gly m 6

Cleaved into: Glycinin A1b subunit
Glycinin A subunit
; Glycinin B2 subunit
Glycinin B subunit
Gene Name GY3 Glyma19g34780
Organism Glycine max (Soybean) (Glycine hispida)
Taxonomic Lineage cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen. Soja Glycine max (Soybean) (Glycine hispida)
Enzyme Sequence MAKLVLSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQQKGQSSRPQDRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNNPFSFLVPPKESQRRVVA
Enzyme Length 481
Uniprot Accession Number P11828
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Glycinin is the major seed storage protein of soybean (PubMed:2485233). Glycinin basic peptides (GBPs), and, to a lower extent, glycinin exhibit antibacterial activity against Gram-negative and Gram-positive bacteria (e.g. L.monocytogenes, B.subtilis, E.coli and S.enteritidis) by forming pores and aggregating in transmembranes, leading to membrane permeability and, eventually, cell death (PubMed:22236762, Ref.12, PubMed:28590128). {ECO:0000269|PubMed:22236762, ECO:0000269|PubMed:2485233, ECO:0000269|PubMed:28590128, ECO:0000269|Ref.12}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Alternative sequence (1); Chain (2); Compositional bias (1); Disulfide bond (2); Domain (2); Motif (1); Propeptide (1); Region (2); Sequence conflict (17); Signal peptide (1)
Keywords Allergen;Alternative splicing;Disulfide bond;Endoplasmic reticulum;Reference proteome;Seed storage protein;Signal;Storage protein;Vacuole
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Endoplasmic reticulum {ECO:0000250|UniProtKB:P04776}. Protein storage vacuole {ECO:0000250|UniProtKB:P04776}. Note=Hexamers are assembled in the endoplasmic reticulum and later sorted to the protein storage vacuoles. {ECO:0000250|UniProtKB:P04776}.
Modified Residue
Post Translational Modification PTM: During soybean germination, seed storage proteins are hydrolyzed by protease/26S proteasome. {ECO:0000269|PubMed:29037738}.
Signal Peptide SIGNAL 1..21; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif MOTIF 472..481; /note=Vacuolar targeting signal; /evidence=ECO:0000250|UniProtKB:P04776
Gene Encoded By
Mass 54,242
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda