| IED ID | IndEnz0002004011 |
| Enzyme Type ID | protease004011 |
| Protein Name |
Bowman-Birk type proteinase inhibitor 1 LSI-1 Fragments |
| Gene Name | |
| Organism | Lathyrus sativus (White vetchling) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Lathyrus Lathyrus sativus (White vetchling) |
| Enzyme Sequence | GDDVKSACCDTCLCTKSNPPICRCVDIRETCHSACNSCVCTASIPPQCRFCYK |
| Enzyme Length | 53 |
| Uniprot Accession Number | P86701 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin (IC(50)=6.20 nM), neutrophil elastase (ELANE) and, to a lesser extent, alpha-chymotrypsin (IC(50)=3.44 uM). {ECO:0000269|PubMed:21647515}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (6); Non-adjacent residues (1); Non-terminal residue (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,751 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |