| IED ID | IndEnz0002004021 |
| Enzyme Type ID | protease004021 |
| Protein Name |
Protease A inhibitor 3 Proteinase inhibitor I A 3 Proteinase yscA-inhibitor Saccharopepsin inhibitor |
| Gene Name | PAI3 YMR174C YM8010.04C |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MNTDQQKVSEIFQSSKEKLQGDAKVVSDAFKKMASQDKDGKTTDADESEKHNYQEQYNKLKGAGHKKE |
| Enzyme Length | 68 |
| Uniprot Accession Number | P01094 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Specific and potent inhibitor for yeast aspartic protease A (yscA). The proteinase acts as a folding template stabilizing the helical conformation in the inhibitor, which results in the potent and specific blockage of the proteolytic activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (2); Helix (1); Modified residue (1); Region (3) |
| Keywords | 3D-structure;Acetylation;Aspartic protease inhibitor;Direct protein sequencing;Protease inhibitor;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0000269|Ref.1 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 1DP5; 1DPJ; 1G0V; |
| Mapped Pubmed ID | 10930843; 11042188; 15065849; 16606443; 16895485; 17087512; 17145748; 17608726; 18681437; 19003993; 19536198; 21490720; 23202731; 23514415; 24040173; 3907626; 6989820; 8801420; |
| Motif | |
| Gene Encoded By | |
| Mass | 7,707 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |