| IED ID | IndEnz0002004024 |
| Enzyme Type ID | protease004024 |
| Protein Name |
Macrophage migration inhibitory factor MIF EC 5.3.2.1 Delayed early response protein 6 DER6 Glycosylation-inhibiting factor GIF L-dopachrome isomerase L-dopachrome tautomerase EC 5.3.3.12 Phenylpyruvate tautomerase |
| Gene Name | Mif |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA |
| Enzyme Length | 115 |
| Uniprot Accession Number | P34884 |
| Absorption | |
| Active Site | ACT_SITE 2; /note=Proton acceptor; via imino nitrogen |
| Activity Regulation | |
| Binding Site | BINDING 33; /note=Substrate; BINDING 65; /note=Substrate; via amide nitrogen; /evidence=ECO:0000250; BINDING 98; /note=Substrate |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=3-phenylpyruvate = enol-phenylpyruvate; Xref=Rhea:RHEA:17097, ChEBI:CHEBI:16815, ChEBI:CHEBI:18005; EC=5.3.2.1; Evidence={ECO:0000269|PubMed:19188446}; CATALYTIC ACTIVITY: Reaction=L-dopachrome = 5,6-dihydroxyindole-2-carboxylate; Xref=Rhea:RHEA:13041, ChEBI:CHEBI:16875, ChEBI:CHEBI:57509; EC=5.3.3.12; Evidence={ECO:0000269|PubMed:19188446}; |
| DNA Binding | |
| EC Number | 5.3.2.1; 5.3.3.12 |
| Enzyme Function | FUNCTION: Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity). {ECO:0000250|UniProtKB:P14174}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (6); Binding site (3); Chain (1); Helix (6); Initiator methionine (1); Modified residue (2); Mutagenesis (1) |
| Keywords | 3D-structure;Acetylation;Cytokine;Cytoplasm;Direct protein sequencing;Immunity;Inflammatory response;Innate immunity;Isomerase;Reference proteome;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:17526494, ECO:0000269|PubMed:8234256}. Cytoplasm {ECO:0000250|UniProtKB:P14174}. Note=Does not have a cleavable signal sequence and is secreted via a specialized, non-classical pathway. Secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens (By similarity). {ECO:0000250|UniProtKB:P14174}. |
| Modified Residue | MOD_RES 78; /note=N6-acetyllysine; alternate; /evidence=ECO:0007744|PubMed:23806337; MOD_RES 78; /note=N6-succinyllysine; alternate; /evidence=ECO:0007744|PubMed:23806337 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 1MFF; 1MFI; 2GDG; |
| Mapped Pubmed ID | 10051316; 10364264; 10473131; 10613844; 10706738; 10809963; 11217851; 11488984; 11668338; 11756671; 11773615; 11780066; 12209330; 12218292; 12271144; 12297513; 12466851; 12538581; 12538686; 12727922; 12778465; 12788306; 12796500; 12814949; 12865817; 12878730; 12919089; 12946935; 12958152; 12964047; 14502271; 14610273; 14681479; 14717917; 14736878; 14751814; 15197138; 15645444; 15664192; 15709171; 15751084; 15761851; 15790730; 15807847; 15840582; 15922619; 15942688; 15947793; 16141072; 16162108; 16186482; 16237048; 16283355; 16285950; 16293799; 16314467; 16314470; 16442103; 16442105; 16522371; 16574946; 16602821; 16636133; 16714544; 16751997; 16753018; 16835407; 16860715; 16872482; 16982923; 17015758; 17045821; 17049622; 17056501; 17142669; 17210698; 17290223; 17316137; 17373669; 17390393; 17435771; 17620429; 17634366; 17640378; 17650334; 17652722; 17854804; 17909632; 17911626; 18022162; 18055556; 18056708; 18064633; 18097062; 18171979; 18235500; 18311142; 18436209; 18439915; 18606868; 18624729; 18641325; 18653719; 18684922; 18703634; 18815136; 18821693; 18832726; 18852457; 18952710; 19009023; 19034004; 19036925; 19088181; 19125256; 19155217; 19179453; 19188484; 19196797; 19286569; 19413900; 19478200; 19584138; 19591967; 19695172; 19744492; 19747950; 19776337; 19905972; 19920350; 19941385; 19966563; 20004020; 20096683; 20127836; 20169062; 20177408; 20203087; 20219983; 20331989; 20361053; 20539011; 20566490; 20581170; 20606117; 20684790; 20829434; 20831446; 20923497; 20939898; 20950810; 21106847; 21116636; 21152395; 21191413; 21215754; 21239607; 21267068; 21281800; 21293254; 21325249; 21411731; 21452319; 21518974; 21536912; 21559932; 21571101; 21677750; 21714902; 21730129; 21817065; 21905163; 21969590; 21977228; 22016007; 22110382; 22217210; 22253816; 22271573; 22340465; 22454509; 22461508; 22575600; 22592805; 22774990; 22778413; 22826223; 22848081; 22972922; 23085580; 23118218; 23125418; 23137174; 23144312; 23172918; 23174952; 23372160; 23376686; 23390297; 23410506; 23503937; 23526214; 23637753; 23674514; 23753877; 23776208; 23777345; 23797673; 23804488; 23823021; 23834778; 23868943; 23882081; 24003215; 24006456; 24098445; 24154525; 24334905; 24441872; 24472542; 24490973; 24504014; 24586879; 24683185; 24760155; 24862346; 24928996; 24970391; 24983315; 25016026; 25022960; 25118614; 25122558; 25172501; 25194790; 25255103; 25266363; 25329068; 25398607; 25412423; 25425146; 25561410; 25609432; 25647268; 25647395; 25661015; 25706271; 25712805; 25826675; 25853607; 25943202; 25961459; 25985394; 26020638; 26028220; 26091949; 26139098; 26310191; 26338025; 26348853; 26400205; 26403072; 26455966; 26858459; 26868525; 26940544; 27035848; 27049059; 27082509; 27129368; 27157615; 27163877; 27164411; 27181906; 27197190; 27273604; 27364992; 27528627; 27551074; 27564840; 27632207; 27699180; 27825106; 27846469; 27925200; 27955690; 28070752; 28539339; 28574571; 28743960; 28768722; 28780379; 28801314; 28904129; 28919555; 28923927; 28990052; 29084983; 29247872; 29263120; 29350381; 29401625; 29440696; 29504609; 29543531; 29679061; 29702687; 29769287; 29864117; 29884801; 29908183; 30077612; 30252532; 30295645; 30333830; 30400058; 30471926; 30567353; 30569239; 30708129; 30737274; 30804219; 30817226; 30944975; 31221018; 31292300; 31381889; 31484822; 31669150; 31708110; 31708913; 31794879; 31821259; 31906137; 31948762; 32062385; 32265835; 32303185; 32339783; 32885302; 33246771; 33525493; 33542244; 33661886; 34273844; 34850744; 34921640; 8832282; 8835541; 8903731; 8958058; 9002552; 9027512; 9164975; 9395080; 9628829; 9653653; 9716662; 9892616; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,504 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:17097; RHEA:13041 |
| Cross Reference Brenda | 5.3.2.1; |