| IED ID | IndEnz0002004043 |
| Enzyme Type ID | protease004043 |
| Protein Name |
Cysteine protease Nivulian-2 Nivulian-II EC 3.4.22.- Fragments |
| Gene Name | |
| Organism | Euphorbia nivulia (Leafy milk hedge) (Euphorbia varians) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Euphorbiaceae Euphorbioideae Euphorbieae Euphorbia (spurges) Euphorbia subgen. Euphorbia Euphorbia sect. Euphorbia Euphorbia nivulia (Leafy milk hedge) (Euphorbia varians) |
| Enzyme Sequence | DFPPNTCCCICCFIDRMYQQNHFIISSNSNSSNQNKLVSSLEGKVWVQDVPSLHLLRFFLYEYRNWNSFITPKKCESMFVFLRDPFIHYVRYQAKSFLAARGTPLMMNKSQMLENSFLIDIAINKAKFCNALGHPISKPVRVWYLDIIRINDLVNHD |
| Enzyme Length | 157 |
| Uniprot Accession Number | P86837 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by HgCl(2), iodoacetamide (IAA) and, to a far lesser extent, by PMSF, Pepstatin A and EDTA. {ECO:0000269|Ref.1}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Cysteine protease inducing milk clotting by cleaving casein. {ECO:0000269|Ref.1}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 50 degrees Celsius. {ECO:0000269|Ref.1}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.3. {ECO:0000269|Ref.1}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (8); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Hydrolase;Protease;Thiol protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,436 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |