| IED ID | IndEnz0002004091 |
| Enzyme Type ID | protease004091 |
| Protein Name |
Late L2 mu core protein Protein X pX pMu |
| Gene Name | PX |
| Organism | Fowl adenovirus A serotype 1 (strain CELO / Phelps) (FAdV-1) (Avian adenovirus gal1 (strain Phelps)) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Aviadenovirus Fowl aviadenovirus A Fowl adenovirus A serotype 1 (strain CELO / Phelps) (FAdV-1) (Avian adenovirus gal1 (strain Phelps)) |
| Enzyme Sequence | MCAVAIHRSDVVMPSVLLTGGRTAKGKKRASRRRVKVPKLPKGARRKRASVTPVPTVATATASERAALTNLARRLQRGDYAAWRPADYTSPAVSEAARAAASSGTPATARDLATGTLARAVPMTGTGGRRRKRTATRRRSLKGGFLPALIPIIAAAIGAIPGIAGTAVGIANLKEQQRQFNKIYGDKK |
| Enzyme Length | 188 |
| Uniprot Accession Number | Q64756 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: The role of the precursor might be to condense the viral prochromatin for encapsidation by virtue of the two basic domains. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Compositional bias (1); Peptide (1); Propeptide (2); Region (1); Site (2) |
| Keywords | DNA-binding;Late protein;Reference proteome;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,789 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |