| IED ID | IndEnz0002004116 |
| Enzyme Type ID | protease004116 |
| Protein Name |
Bowman-Birk type proteinase inhibitor A-II Cleaved into: Bowman-Birk type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III |
| Gene Name | |
| Organism | Arachis hypogaea (Peanut) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade dalbergioids sensu lato Dalbergieae Pterocarpus clade Arachis Arachis hypogaea (Peanut) |
| Enzyme Sequence | EASSSSDDNVCCNGCLCDRRAPPYFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQGRCPVTECRS |
| Enzyme Length | 70 |
| Uniprot Accession Number | P01066 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: These proteins inhibit trypsin and chymotrypsin, having 2 sites of interaction with trypsin. The site of interaction with chymotrypsin has not been determined but is not independent of the trypsin-reactive sites. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (4); Disulfide bond (7); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,633 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |