| IED ID | IndEnz0002004128 |
| Enzyme Type ID | protease004128 |
| Protein Name |
Serine protease inhibitor Kazal-type 2 Acrosin-trypsin inhibitor Epididymis tissue protein Li 172 HUSI-II |
| Gene Name | SPINK2 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC |
| Enzyme Length | 84 |
| Uniprot Accession Number | P20155 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: As a strong inhibitor of acrosin, it is required for normal spermiogenesis. It probably hinders premature activation of proacrosin and other proteases, thus preventing the cascade of events leading to spermiogenesis defects (PubMed:28554943). May be involved in the regulation of serine protease-dependent germ cell apoptosis (By similarity). It also inhibits trypsin. {ECO:0000250|UniProtKB:Q8BMY7, ECO:0000269|PubMed:19422058, ECO:0000269|PubMed:28554943}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (3); Domain (1); Helix (2); Modified residue (1); Mutagenesis (4); Signal peptide (1); Site (1) |
| Keywords | 3D-structure;Cytoplasmic vesicle;Direct protein sequencing;Disulfide bond;Protease inhibitor;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | Q6UY14-3; P28799; Q9Y5K2; P26371; Q7Z3S9; P49788; O76024 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. Cytoplasmic vesicle, secretory vesicle, acrosome {ECO:0000269|PubMed:28554943}. |
| Modified Residue | MOD_RES 24; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:2226783 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000269|PubMed:2226783 |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (1) |
| Cross Reference PDB | 2JXD; 6KBR; |
| Mapped Pubmed ID | 17333166; 25416956; 25814554; 31391482; 31886233; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,291 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |