| IED ID | IndEnz0002004137 |
| Enzyme Type ID | protease004137 |
| Protein Name |
Alkaline proteinase inhibitor 11 kDa protease inhibitor SmaPI |
| Gene Name | inh |
| Organism | Serratia marcescens |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Serratia Serratia marcescens |
| Enzyme Sequence | MKGTLTRAALAAGGMMVTSAVMAGSLALPTAQSLAGQWEVADSERQCQIEFLANEQSETNGYQLVDRQRCLQSVFAAEVVAGAGPDGIALLQADGSTLAFFSRDGDLYRNQLGAGDALTLKALA |
| Enzyme Length | 124 |
| Uniprot Accession Number | Q54478 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of the alkaline protease. Inhibits SMP by formation of a non-covalent complex with a molar ratio of 1:1 and shows a high specificity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Signal peptide (1) |
| Keywords | Disulfide bond;Metalloenzyme inhibitor;Metalloprotease inhibitor;Periplasm;Protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,883 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |