| IED ID | IndEnz0002004148 |
| Enzyme Type ID | protease004148 |
| Protein Name |
Kininogen Cleaved into: Bradykinin Fragments |
| Gene Name | |
| Organism | Gadus morhua (Atlantic cod) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Neoteleostei Eurypterygia Ctenosquamata Acanthomorphata Paracanthopterygii Zeiogadaria Gadariae Gadiformes (cods and others) Gadoidei Gadidae (cods) Gadus Gadus morhua (Atlantic cod) |
| Enzyme Sequence | RHEVPQANLECDEGAMDLKISTGNMVALYQILSASKDSDCPAGGAVTWTDQVVAGLRICMGCPVELDLESEELKVPVAVSISKRRPPGWSPLRAAVTSFNEKEFSPPAPPSRAEYSLYFDMRK |
| Enzyme Length | 123 |
| Uniprot Accession Number | P83856 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits papain and ficin (cysteine proteinases) but not trypsin (a serine proteinase). {ECO:0000269|PubMed:12047371}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (8); Non-terminal residue (2); Peptide (1) |
| Keywords | Cleavage on pair of basic residues;Direct protein sequencing;Glycoprotein;Protease inhibitor;Thiol protease inhibitor;Vasoactive;Vasodilator |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Bradykinin is released from kininogen by kallikrein. {ECO:0000250|UniProtKB:P01042}.; PTM: N-glycosylated. Contains sulfated N-acetylglucosamine and O-acetylated sialic acids as terminal elements on biantennary and triantennary N-glycans. {ECO:0000269|PubMed:12047371}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 13,427 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |