| IED ID | IndEnz0002004174 |
| Enzyme Type ID | protease004174 |
| Protein Name |
Ovocalyxin-32 OCX-32 32 kDa eggshell matrix protein |
| Gene Name | |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | MPGLRAALPAALLLLSSFPPAAAERLPWPQVPGVMRPLNPSHREAVWAAWTALHYINSHEASPSRPLALHKVVKAASKMIPRLGWKYYVHCTTEGYIHGENAGSCFATVLYLKKSPPVVHGKCVHAQNKKQIQEEDHRFYEYLQHQKKPITANYIPDSNGNIAHDHLQLWGLAIVGSSYIMWKQSTEHTGYLLAQVSSVKQQIRKDNAVAFKFIVLLHEIPTQQLNVCHMYLVWTLGHPIRVKYSCAPDNHGLEDGSGQDSGSAAGTSHETKGNF |
| Enzyme Length | 275 |
| Uniprot Accession Number | Q90YI1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the matrix of the eggshell. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Region (1); Signal peptide (1) |
| Keywords | Biomineralization;Direct protein sequencing;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 19903948; 20331600; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,634 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |