| IED ID | IndEnz0002004184 |
| Enzyme Type ID | protease004184 |
| Protein Name |
Probable mRNA interferase toxin HicA EC 3.1.-.- Endoribonuclease HicA Toxin HicA |
| Gene Name | hicA yncN b4532 JW5230 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS |
| Enzyme Length | 58 |
| Uniprot Accession Number | P76106 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Toxic component of a type II toxin-antitoxin (TA) system. A probable translation-independent mRNA interferase. Overexpression causes cessation of cell growth and inhibits cell proliferation via inhibition of translation; this blockage is overcome (after 90 minutes) by subsequent expression of antitoxin HicB. Overexpression causes cleavage of a number of mRNAs and tmRNA, in a translation-independent fashion, suggesting this is an mRNA interferase (PubMed:19060138). {ECO:0000269|PubMed:19060138}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (3); Chain (1); Helix (2) |
| Keywords | 3D-structure;Endonuclease;Hydrolase;Nuclease;RNA-binding;Reference proteome;Stress response;Toxin-antitoxin system |
| Interact With | |
| Induction | INDUCTION: Induced by amino acid starvation, carbon starvation and when translation is blocked. Induction no longer occurs in the absence of Lon protease suggesting, by homology to other toxin-antitoxin systems, that it may degrade the HicB antitoxin. A member of the hicA-hicB operon. {ECO:0000269|PubMed:19060138}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 6HPB; |
| Mapped Pubmed ID | 24561554; 31495532; |
| Motif | |
| Gene Encoded By | |
| Mass | 6,782 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |