| IED ID | IndEnz0002004190 |
| Enzyme Type ID | protease004190 |
| Protein Name |
Hirullin-P18 Hirudin-P18 Thrombin inhibitor hirullin P18 |
| Gene Name | |
| Organism | Poecilobdella manillensis (Mexican medical leech) (Hirudinaria manillensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Clitellata Hirudinea (leeches) Hirudinida Hirudiniformes Hirudinidae Poecilobdella Poecilobdella manillensis (Mexican medical leech) (Hirudinaria manillensis) |
| Enzyme Sequence | VSYTDCTSGQNYCLCGGNFCGDGKHCEMDGSENKCVDGEGTPKRQTSGPSDFEEFSLDDIEQ |
| Enzyme Length | 62 |
| Uniprot Accession Number | P26631 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits thrombin, thereby abolishing its ability to cleave fibrinogen. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Glycosylation (1); Region (3); Site (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: O-linked glycan consists of Fuc-Gal-GalNAc trisaccharide. {ECO:0000269|PubMed:1540584}. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1THR; |
| Mapped Pubmed ID | 8376390; |
| Motif | |
| Gene Encoded By | |
| Mass | 6,693 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |