| IED ID | IndEnz0002004207 |
| Enzyme Type ID | protease004207 |
| Protein Name |
Hirudin-2B Hirudin IIB |
| Gene Name | |
| Organism | Hirudo medicinalis (Medicinal leech) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Clitellata Hirudinea (leeches) Hirudinida Hirudiniformes Hirudinidae Hirudo Hirudo medicinalis (Medicinal leech) |
| Enzyme Sequence | ITYTDCTESGQNLCLCEGSNVCGKGNKCILGSNGEENQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
| Enzyme Length | 65 |
| Uniprot Accession Number | P28506 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Glycosylation (1); Helix (1); Modified residue (1); Region (3) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Secreted;Serine protease inhibitor;Sulfation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 63; /note=Sulfotyrosine; /evidence=ECO:0000250 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (10) |
| Cross Reference PDB | 1FPH; 1G30; 1G32; 1KTS; 1KTT; 1MU6; 1MU8; 1MUE; 1OYT; 1RIW; |
| Mapped Pubmed ID | 11342132; 11960487; 12570369; 12657281; 12800172; 15137772; 1587268; |
| Motif | |
| Gene Encoded By | |
| Mass | 6,986 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |