| IED ID | IndEnz0002004305 |
| Enzyme Type ID | protease004305 |
| Protein Name |
Oligopeptide-binding protein OppA Stage 0 sporulation protein KA |
| Gene Name | oppA spo0KA BSU11430 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MKKRWSIVTLMLIFTLVLSACGFGGTGSNGEGKKDSKGKTTLNINIKTEPFSLHPGLANDSVSGGVIRQTFEGLTRINADGEPEEGMASKIETSKDGKTYTFTIRDGVKWSNGDPVTAQDFEYAWKWALDPNNESQYAYQLYYIKGAEAANTGKGSLDDVAVKAVNDKTLKVELNNPTPYFTELTAFYTYMPINEKIAEKNKKWNTNAGDDYVSNGPFKMTAWKHSGSITLEKNDQYWDKDKVKLKKIDMVMINNNNTELKKFQAGELDWAGMPLGQLPTESLPTLKKDGSLHVEPIAGVYWYKFNTEAKPLDNVNIRKALTYSLDRQSIVKNVTQGEQMPAMAAVPPTMKGFEDNKEGYFKDNDVKTAKEYLEKGLKEMGLSKASDLPKIKLSYNTDDAHAKIAQAVQEMWKKNLGVDVELDNSEWNVYIDKLHSQDYQIGRMGWLGDFNDPINFLELFRDKNGGNNDTGWENPEFKKLLNQSQTETDKTKRAELLKKAEGIFIDEMPVAPIYFYTDTWVQDENLKGVIMPGTGEVYFRNAYFK |
| Enzyme Length | 545 |
| Uniprot Accession Number | P24141 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This protein is a component of the oligopeptide permease, a binding protein-dependent transport system, It binds peptides up to five amino acids long with high affinity. Also required for sporulation and competence. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Lipidation (2); Modified residue (1); Sequence conflict (6); Signal peptide (1) |
| Keywords | Cell membrane;Competence;Lipoprotein;Membrane;Palmitate;Peptide transport;Phosphoprotein;Protein transport;Reference proteome;Signal;Sporulation;Transport |
| Interact With | |
| Induction | INDUCTION: Positively regulated by TnrA under nitrogen-limited conditions. {ECO:0000269|PubMed:12823818}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210, ECO:0000269|PubMed:23651456, ECO:0000305|PubMed:27362352}; Lipid-anchor {ECO:0000305}. Membrane raft {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210, ECO:0000269|PubMed:23651456, ECO:0000305|PubMed:27362352}; Lipid-anchor {ECO:0000305}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:20713508, ECO:0000269|PubMed:22882210, ECO:0000269|PubMed:23651456}. |
| Modified Residue | MOD_RES 470; /note=Phosphothreonine; /evidence=ECO:0000269|PubMed:17218307 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 61,525 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |