| IED ID | IndEnz0002004330 |
| Enzyme Type ID | protease004330 |
| Protein Name |
Gag polyprotein Pr53Gag Cleaved into: Matrix protein p19 MA ; Capsid protein p24 CA ; Nucleocapsid protein p15-gag NC-gag |
| Gene Name | gag |
| Organism | Human T-cell leukemia virus 2 (HTLV-2) |
| Taxonomic Lineage | Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Deltaretrovirus Primate T-lymphotropic virus 2 Human T-cell leukemia virus 2 (HTLV-2) |
| Enzyme Sequence | MGQIHGLSPTPIPKAPRGLSTHHWLNFLQAAYRLQPRPSDFDFQQLRRFLKLALKTPIWLNPIDYSLLASLIPKGYPGRVVEIINILVKNQVSPSAPAAPVPTPICPTTTPPPPPPPSPEAHVPPPYVEPTTTQCFPILHPPGAPSAHRPWQMKDLQAIKQEVSSSALGSPQFMQTLRLAVQQFDPTAKDLQDLLQYLCSSLVVSLHHQQLNTLITEAETRGMTGYNPMAGPLRMQANNPAQQGLRREYQNLWLAAFSTLPGNTRDPSWAAILQGLEEPYCAFVERLNVALDNGLPEGTPKEPILRSLAYSNANKECQKILQARGHTNSPLGEMLRTCQAWTPKDKTKVLVVQPRRPPPTQPCFRCGKVGHWSRDCTQPRPPPGPCPLCQDPSHWKRDCPQLKPPQEEGEPLLLDLPSTSGTTEEKNSLRGEI |
| Enzyme Length | 433 |
| Uniprot Accession Number | P03346 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Gag polyprotein]: The matrix domain targets Gag, Gag-Pro and Gag-Pro-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. {ECO:0000250|UniProtKB:P03345}.; FUNCTION: [Matrix protein p19]: Matrix protein. {ECO:0000250|UniProtKB:P03345}.; FUNCTION: [Capsid protein p24]: Forms the spherical core of the virus that encapsulates the genomic RNA-nucleocapsid complex. {ECO:0000250|UniProtKB:P03345}.; FUNCTION: [Nucleocapsid protein p15-gag]: Binds strongly to viral nucleic acids and promote their aggregation. Also destabilizes the nucleic acids duplexes via highly structured zinc-binding motifs. {ECO:0000250|UniProtKB:P03345}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (4); Compositional bias (1); Initiator methionine (1); Lipidation (1); Motif (2); Region (2); Site (2); Zinc finger (2) |
| Keywords | 3D-structure;Capsid protein;Host-virus interaction;Lipoprotein;Metal-binding;Myristate;Reference proteome;Repeat;Ribosomal frameshifting;Ubl conjugation;Viral nucleoprotein;Virion;Zinc;Zinc-finger |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Matrix protein p19]: Virion {ECO:0000250|UniProtKB:P03345}.; SUBCELLULAR LOCATION: [Capsid protein p24]: Virion {ECO:0000250|UniProtKB:P03345}.; SUBCELLULAR LOCATION: [Nucleocapsid protein p15-gag]: Virion {ECO:0000250|UniProtKB:P03345}. |
| Modified Residue | |
| Post Translational Modification | PTM: [Gag polyprotein]: Specific enzymatic cleavages by the viral protease yield mature proteins. The polyprotein is cleaved during and after budding, this process is termed maturation. {ECO:0000250|UniProtKB:P03345}.; PTM: [Matrix protein p19]: Phosphorylation of the matrix protein p19 by MAPK1 seems to play a role in budding. {ECO:0000250|UniProtKB:P03345}.; PTM: [Gag polyprotein]: Ubiquitinated by host NEDD4. {ECO:0000250|UniProtKB:P03345}.; PTM: [Gag polyprotein]: Myristoylated. Myristoylation of the matrix (MA) domain mediates the transport and binding of Gag polyproteins to the host plasma membrane and is required for the assembly of viral particles. {ECO:0000250|UniProtKB:P03345}. |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1JVR; |
| Mapped Pubmed ID | 22458338; |
| Motif | MOTIF 94..97; /note=PTAP/PSAP motif; /evidence=ECO:0000250|UniProtKB:P03345; MOTIF 124..127; /note=PPXY motif; /evidence=ECO:0000250|UniProtKB:P03345 |
| Gene Encoded By | |
| Mass | 48,028 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |