| IED ID | IndEnz0002004348 |
| Enzyme Type ID | protease004348 |
| Protein Name |
ATP-dependent zinc metalloprotease FTSH, chloroplastic EC 3.4.24.- Fragments |
| Gene Name | |
| Organism | Populus euphratica (Euphrates poplar) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Salicaceae Saliceae Populus (poplars) Populus euphratica (Euphrates poplar) |
| Enzyme Sequence | FLEYLDKDRVRVQLPGLSQELLQKTPGFSGADLANLLNEAAILAGRR |
| Enzyme Length | 47 |
| Uniprot Accession Number | P84578 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Seems to act as an ATP-dependent zinc metallopeptidase. {ECO:0000250|UniProtKB:P28691}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (2); Non-terminal residue (2) |
| Keywords | ATP-binding;Cell cycle;Cell division;Chloroplast;Direct protein sequencing;Hydrolase;Membrane;Metal-binding;Metalloprotease;Nucleotide-binding;Plastid;Protease;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,198 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |