| IED ID | IndEnz0002004438 |
| Enzyme Type ID | protease004438 |
| Protein Name |
Mitochondrial inner membrane protease ATP23 EC 3.4.24.- |
| Gene Name | ATP23 LELG_02418 |
| Organism | Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Debaryomycetaceae Candida/Lodderomyces clade Lodderomyces Lodderomyces elongisporus Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus) |
| Enzyme Sequence | MSSSTQPAQTSPSPSKITLSADSQLNGFEWWRRSLQYQTGLGLTPSEKAQYEYDYFHRNLDQKCDTCNDHLKWVLAYSPSVRFMMDHIQKLNKSNEPVPRNKIVCQTCDFTKGGGFDPNHGIVLCSNYIRSKWQLEDILAHELVHVYDYMKFNVNMLDLRQHACTEIRASMLSGECRVWNEMKKTGMGNFGKKFQECIRRRAVLSVEANPVCKSREEAEKAVDVVWKSCFNDTRPFERVYR |
| Enzyme Length | 241 |
| Uniprot Accession Number | A5DYI1 |
| Absorption | |
| Active Site | ACT_SITE 142; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (2) |
| Keywords | Hydrolase;Membrane;Metal-binding;Metalloprotease;Mitochondrion;Mitochondrion inner membrane;Protease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side. Note=Associates loosely with the inner membrane. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,012 |
| Kinetics | |
| Metal Binding | METAL 141; /note=Divalent metal cation; catalytic; /evidence=ECO:0000250; METAL 145; /note=Divalent metal cation; catalytic; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |