| IED ID | IndEnz0002004447 |
| Enzyme Type ID | protease004447 |
| Protein Name |
Glu S.griseus protease inhibitor BGIA |
| Gene Name | |
| Organism | Momordica charantia (Bitter gourd) (Balsam pear) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Cucurbitales Cucurbitaceae Momordiceae Momordica Momordica charantia (Bitter gourd) (Balsam pear) |
| Enzyme Sequence | SQCQGKRSWPQLVGSTGAAAKAVIERENPRVRAVIVRVGSPVTADFRCDRVRVWVTERGIVARPPAIG |
| Enzyme Length | 68 |
| Uniprot Accession Number | P24076 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Competitively inhibits Glu S.griseus protease by forming probably a 1:1 complex. BGIA has no inhibitory activity against 2 other acidic amino acid-specific endopeptidases (S.aureus protease V8 and B.subtilis proteinase), chymotrypsin, trypsin, pancreatic elastase, and papain, although subtilisin Carlsberg was strongly inhibited. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Modified residue (1); Site (1) |
| Keywords | Acetylation;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 1; /note=N-acetylserine; /evidence=ECO:0000269|PubMed:1679433 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,383 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |