| IED ID | IndEnz0002004451 |
| Enzyme Type ID | protease004451 |
| Protein Name |
Translational regulator CsrA Carbon storage regulator |
| Gene Name | csrA rsmA |
| Organism | Proteus mirabilis |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Morganellaceae Proteus Proteus mirabilis |
| Enzyme Sequence | MLILTRRVGETLMIGDDVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKTQPTDNY |
| Enzyme Length | 62 |
| Uniprot Accession Number | Q93MI1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5'-UTR; binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5'-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA(s). {ECO:0000255|HAMAP-Rule:MF_00167}.; FUNCTION: Expression from a low-copy number plasmid has no effect on swimming, but blocks swarming and virulence factor expression as measured by cell lengthening and hemolysin, protease, urease and flagellin production (PubMed:12488561). Expression destabilizes hemolysin mRNA (PubMed:12488561). Complements an E.coli disruption mutant (PubMed:12488561). {ECO:0000269|PubMed:12488561}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Activator;Cytoplasm;RNA-binding;Repressor;Translation regulation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,981 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |