| IED ID | IndEnz0002004453 |
| Enzyme Type ID | protease004453 |
| Protein Name |
Heptaketide hydrolyase ayg1 EC 3.7.1.- Conidial pigment biosynthesis protein ayg1 |
| Gene Name | ayg1 AFUA_2G17550 |
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Enzyme Sequence | MPRWILGDKFDTVFPHKGSLKVLWESRWKSACSKSVYPFHDGSIEDFEPIFNHLISKNINDAASDEYTQAFLPTASALEEKAAQALQAGKHEEASNLLCRAAVVYRISRFPYVDITKPSSIKRVAFERQKQAYLKATSLWTQPIREVTVPHTYRTGNDGAHIPIYIRTPAGADQSNPVPIVLIMTGLDGYRSDNSQRTHEILARGWAAVVAEIPGTADCPADPADPASPDRLWDSVLSYLDQRPELNTAKMVVWGLSAGGYYAIRAAHTHRDRLLGAIAHGPGCHYYLDPEWLAKVNDHEYPFEITAAWATKHGYKTVEEFVAGAQKKFSLVETGIVDQPSCRLLLLNGVDDGVVPIEDCLVLFEHGSPKEGRFYKGLPHMGYPNSLPVSYEWLEQVLASPSKTKN |
| Enzyme Length | 406 |
| Uniprot Accession Number | Q4WZB3 |
| Absorption | |
| Active Site | ACT_SITE 257; /note=Nucleophile; /evidence=ECO:0000269|PubMed:15310761; ACT_SITE 352; /evidence=ECO:0000269|PubMed:15310761; ACT_SITE 380; /evidence=ECO:0000269|PubMed:15310761 |
| Activity Regulation | ACTIVITY REGULATION: Serine protease inhibitors strongly inhibit activity (PubMed:15310761). Moreover, 3,4-dichloroisocoumarinshows and 2-acetyl-1,3,6,8-tetrahydroxynaphthalene act also as a strong inhibitor (PubMed:15310761). {ECO:0000269|PubMed:15310761}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.7.1.- |
| Enzyme Function | FUNCTION: Heptaketide hydrolyase; part of the gene cluster that mediates the biosynthesis of dihydroxynaphthalene (DHN)-melanin, a bluish-green pigment and a structural component of the conidial wall (PubMed:10515939, PubMed:11350964, PubMed:15310761, PubMed:19156203). The first step of the pathway is the production of the heptaketide naphtopyrone YWA1 by the polyketide synthase alb1 though condensation of acetyl-CoA with malonyl-CoA (PubMed:10515939). The naphtopyrone YWA1 is then converted to the pentaketide 1,3,6,8-tetrahydroxynaphthalene (1,3,6,8-THN) by the heptaketide hydrolyase ayp1 though chain-length shortening (PubMed:10515939, PubMed:11350964). 1,3,6,8-THN is substrate of the hydroxynaphthalene reductase arp2 to yield scytalone (PubMed:10515939, PubMed:11350964, PubMed:15310761). The scytalone dehydratase arp1 then reduces scytalone to 1,3,8-THN (PubMed:10515939). 1,3,8-THN is also substrate of the hydroxynaphthalene reductase arp2 to yield vermelone (PubMed:10515939). Vermelone is further converted by the multicopper oxidase abr1 to 1,8-DHN (PubMed:10515939). Finally the laccase abr2 transforms 1,8-DHN to DHN-melanin (PubMed:10515939). DHN-melanin biosynthesis appears to be initiated in endosomes where early enzymes (abl1, ayg1, arp1 and arp2) localize, with exocytosis leading to melanin deposition on the cell surface where late enzymes (abr1 and abr2) localize (PubMed:26972005). DHN-melanin is an important structural component of the outer cell wall and is required for the presence of conidial surface hydrophobins (PubMed:19703288). DHN-melanin plays also a crucial role in fungal virulence, including a protective role against the host's immune defenses (PubMed:19156203, PubMed:20145078, PubMed:21501368, PubMed:21747802, PubMed:21573171, PubMed:24818666). DHN-melanin protects also conidia against amoeba predation (PubMed:25684622). {ECO:0000269|PubMed:10515939, ECO:0000269|PubMed:11350964, ECO:0000269|PubMed:15310761, ECO:0000269|PubMed:19156203, ECO:0000269|PubMed:19703288, ECO:0000269|PubMed:20145078, ECO:0000269|PubMed:21501368, ECO:0000269|PubMed:21573171, ECO:0000269|PubMed:21747802, ECO:0000269|PubMed:24818666, ECO:0000269|PubMed:25684622, ECO:0000269|PubMed:26972005}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Pigment biosynthesis; melanin biosynthesis. {ECO:0000269|PubMed:10515939}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Mutagenesis (3) |
| Keywords | Endosome;Hydrolase;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endosome {ECO:0000269|PubMed:26972005}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 45,217 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=44 uM for naphtopyrone YWA1 {ECO:0000269|PubMed:15310761}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |