| IED ID | IndEnz0002004459 |
| Enzyme Type ID | protease004459 |
| Protein Name |
COP9 signalosome complex subunit 5 Dch5 Signalosome subunit 5 EC 3.4.-.- JAB1 homolog |
| Gene Name | CSN5 quo CG14884 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MDSDAAQKTWELENNIQTLPSCDEIFRYDAEQQRQIIDAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNEKRSEDKLSKATRDCSRSTIELIHGLMAQIVKDKLFNKVGLGK |
| Enzyme Length | 327 |
| Uniprot Accession Number | Q9XZ58 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. The CSN complex plays an essential role in oogenesis and embryogenesis and is required for proper photoreceptor R cell differentiation and promote lamina glial cell migration or axon targeting. It also promotes Ubl-dependent degradation of cyclin E (CycE) during early oogenesis. Also involved in regulation of axis formation by checkpoint-dependent, translational control of Gurken. {ECO:0000269|PubMed:11779478, ECO:0000269|PubMed:12183637, ECO:0000269|PubMed:12223399, ECO:0000269|PubMed:12397113, ECO:0000269|PubMed:12737805}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Erroneous initiation (1); Metal binding (3); Modified residue (3); Motif (1); Mutagenesis (6); Sequence conflict (3) |
| Keywords | Cytoplasm;Developmental protein;Differentiation;Hydrolase;Metal-binding;Metalloprotease;Nucleus;Oogenesis;Phosphoprotein;Protease;Reference proteome;Signalosome;Zinc |
| Interact With | Q9VCY3; Q7KRW1 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305|PubMed:10531038}. Nucleus {ECO:0000305|PubMed:10531038}. |
| Modified Residue | MOD_RES 300; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:18327897; MOD_RES 302; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:18327897; MOD_RES 303; /note=Phosphothreonine; /evidence=ECO:0000269|PubMed:18327897 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10471706; 10782111; 12415283; 12593986; 12850443; 14570571; 14578910; 14605208; 15037551; 15474165; 15571808; 15575970; 15857915; 15922834; 15927177; 16127432; 16216235; 16496002; 17041588; 17251548; 17295838; 17486136; 18298797; 18493598; 18782863; 18926707; 19064709; 19176824; 19363474; 19855832; 19859546; 20068067; 20691177; 20800474; 21145488; 21205937; 21548953; 21576393; 21849035; 22036573; 22050674; 22589731; 22935612; 22937016; 23071443; 23275879; 23583758; 23637332; 23899565; 24362437; 24576427; 25106867; 25119050; 25312911; 25329560; 25393278; 25459658; 25992709; 26672093; 26870755; 26912791; 28619822; 29029226; 29764959; 32653676; 33382409; 33535499; 33561251; 33988679; |
| Motif | MOTIF 135..148; /note=JAMM motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Gene Encoded By | |
| Mass | 37,083 |
| Kinetics | |
| Metal Binding | METAL 135; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 137; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 148; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Rhea ID | |
| Cross Reference Brenda |