| IED ID | IndEnz0002004495 |
| Enzyme Type ID | protease004495 |
| Protein Name |
Major capsid protein Gene product 4 gp4 Major head protein |
| Gene Name | ORF4 |
| Organism | Pseudomonas phage KPP10 (Bacteriophage KPP10) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Nankokuvirus Pseudomonas virus KPP10 Pseudomonas phage KPP10 (Bacteriophage KPP10) |
| Enzyme Sequence | MRPIPSLQNNFEYTDLTEPMILIPNVWGLTQQLGIFGVDRTTQESVTLEEITKSFGLMEDIHRGARHQVGRDYDRQMRTFAVPHFTYDDYITPRDIQGKRAYGKQELETLDQVRMRKLERLRGTHAATMEFARMHTLVTGKPYTPNNTVGGATGYDWYQEFGKTRFEVNFELDTPTTNILEKSELVYAHMQDEAYTGGVVGDVIAICSPEFFSKLISHPTVVEAYKYYASQPQILRERLRARGFDARYREFYFGNVLYIEYRGGFQGRPGGEKRRYVPAGEAVFIPGSGTEDLFKTFFAPASKFEHVNTPGEESYAFEYVDPKGEFLEINSETNFINVLMYPQLVVKGKAA |
| Enzyme Length | 351 |
| Uniprot Accession Number | D6RRG1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Assembles to form an icosahedral capsid. The assembly is primed by the interaction between capsid assembly protease and portal dodecamer, and major capsid proteins assemble cooperatively to form the procapsid with the help of capsid scaffolding protein. Major capsid protein forms hexons and pentons of the icosahedron. Viral genomic DNA is packaged into the procapsid through the portal vertex. The packaging triggers a dramatic reconfiguration of the capsid shell. {ECO:0000255|HAMAP-Rule:MF_04133}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Capsid protein;Direct protein sequencing;Host cytoplasm;Late protein;Reference proteome;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000255|HAMAP-Rule:MF_04133, ECO:0000269|PubMed:22218962}. Host cytoplasm {ECO:0000255|HAMAP-Rule:MF_04133}. Note=Forms the capsid icosahedric shell. {ECO:0000255|HAMAP-Rule:MF_04133}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 40,277 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |