IED ID | IndEnz0002004527 |
Enzyme Type ID | protease004527 |
Protein Name |
Clitocypin-6 Cysteine protease inhibitor clt6 |
Gene Name | clt6 |
Organism | Clitocybe nebularis (Clouded agaric) (Lepista nebularis) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Tricholomataceae Clitocybe Clitocybe nebularis (Clouded agaric) (Lepista nebularis) |
Enzyme Sequence | MASLEDGTYRLRAVTTHNPDPGVGGEYATVEGARQPVKAEPNTPPFFERQYWQVTRNADGQYTIKYQGLNTPFEYGFSYDELEPNAPVIAGDPKEYILQLVPSTTDVYIIRAPIQRVGVDVEVGVQENTLVYKIFPVDGSGGDKAAWRFTRE |
Enzyme Length | 152 |
Uniprot Accession Number | Q3Y9I5 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Binds and inhibits cysteine proteinases. Inhibits most strongly papain and cathepsin L, more weakly bromelain and cathepsin B while it is completely ineffective against cathepsin H. {ECO:0000250|UniProtKB:Q9P4A2}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1) |
Keywords | Protease inhibitor;Thiol protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Note=Not secreted. {ECO:0000250|UniProtKB:Q9P4A2}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 16,991 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |