| IED ID | IndEnz0002004541 |
| Enzyme Type ID | protease004541 |
| Protein Name |
Minor capsid protein CPm p24 |
| Gene Name | ORF5 |
| Organism | Beet yellows virus (isolate Ukraine) (BYV) (Sugar beet yellows virus) |
| Taxonomic Lineage | Viruses Riboviria Orthornavirae Kitrinoviricota Alsuviricetes Martellivirales Closteroviridae Closterovirus Beet yellows virus Beet yellows virus (isolate Ukraine) (BYV) (Sugar beet yellows virus) |
| Enzyme Sequence | MLAPEARGDLIHFTENTRDAMETFFNSYDLAEYSEVNPNKLNRKETDELLGVIRERFKSELVITDEDFVKHLAFALIRAANITTSVKVNYVGAYEYTIGGKKFLVKDAWVFPLIKECMKKFNKPNPVRTFCATFEDAYIVIARSLPKLFLNRTIGKRGIPSGYEFLGADFLTATSVCLNDHEKAIVLQASRAAIDRAVSSSVDGKIVSLFDLGRLS |
| Enzyme Length | 216 |
| Uniprot Accession Number | Q08538 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component that constitutes the tail found at one end of the virion. Together with Hsp70h and p64, encapsidates the 5'-terminal portion of the viral genome. Movement protein that is involved in local cell-cell movement via plamodesmata. At least five viral proteins, CP, CPm, p6, p64 and Hsp70h are essential for cell-cell movement. {ECO:0000269|PubMed:11742977, ECO:0000269|PubMed:17027895, ECO:0000269|PubMed:9934711}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Capsid protein;Reference proteome;Transport;Viral movement protein;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion. Note=Integral virion tail component. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,288 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |