| IED ID | IndEnz0002004556 |
| Enzyme Type ID | protease004556 |
| Protein Name |
Probable leucine aminopeptidase ARB_00576 EC 3.4.11.- Leucyl aminopeptidase ARB_00576 |
| Gene Name | ARB_00576 |
| Organism | Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Onygenales Arthrodermataceae (dermatophytes) Trichophyton Arthroderma benhamiae (Trichophyton mentagrophytes) Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes) |
| Enzyme Sequence | MKVLAALALSALAMAKPTPPMPGMSLVQTGPQETRWVTAKEKHDMVMNHIGFFDITNRPETASIASKPKSYAFPGNVSHQAEVKPLLEKISADHIKANLEKFSSYPNRYYDAQSGVESAQWVMEQAQAVVGNIQGAKVEMVKHDWMQPSIRAIIPGKSEKIVAVGAHQDSINGNNPQGEAPGADDNGSGSMTILEALTALVSDQKIAGGEAANTLEFHWYAGEEEGLLGSQDIFQQYSQEGKEVVAMLNQDMTGYGETMGVITDNSDPNLTKFTKMILDTYTSAKYSDSECGYACSDHASANKAGFPSAFVYEAVVGQDNPAIHSPDDTIEKLDPAKMAEHAKLVVGFAYELAFATL |
| Enzyme Length | 357 |
| Uniprot Accession Number | D4AWL0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.11.- |
| Enzyme Function | FUNCTION: Probable extracellular aminopeptidase which contributes to pathogenicity. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Glycosylation (3); Metal binding (6); Region (1); Signal peptide (1) |
| Keywords | Aminopeptidase;Disulfide bond;Glycoprotein;Hydrolase;Metal-binding;Protease;Reference proteome;Secreted;Signal;Virulence;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..15; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,497 |
| Kinetics | |
| Metal Binding | METAL 167; /note=Zinc 1; /evidence=ECO:0000250; METAL 185; /note=Zinc 1; /evidence=ECO:0000250; METAL 185; /note=Zinc 2; catalytic; /evidence=ECO:0000250; METAL 224; /note=Zinc 2; catalytic; /evidence=ECO:0000250; METAL 251; /note=Zinc 1; /evidence=ECO:0000250; METAL 324; /note=Zinc 2; catalytic; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |