| IED ID | IndEnz0002004599 |
| Enzyme Type ID | protease004599 |
| Protein Name |
Deubiquitinase DESI2 EC 3.4.19.12 Desumoylating isopeptidase 2 DeSI-2 PPPDE peptidase domain-containing protein 1 Protein FAM152A |
| Gene Name | Desi2 Fam152a Pppde1 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNAAELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASTAMASAAAGGRTGRHTKL |
| Enzyme Length | 194 |
| Uniprot Accession Number | Q5XIT6 |
| Absorption | |
| Active Site | ACT_SITE 30; /evidence="ECO:0000255|PROSITE-ProRule:PRU01205"; ACT_SITE 108; /evidence="ECO:0000250|UniProtKB:Q9BSY9, ECO:0000255|PROSITE-ProRule:PRU01205" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:Q9BSY9}; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Has deubiquitinating activity towards 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Deubiquitinates 'Lys-48'-linked polyubiquitination of RPS7 leading to its stabilization. {ECO:0000250|UniProtKB:Q9BSY9}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (1); Region (1) |
| Keywords | Cytoplasm;Hydrolase;Protease;Reference proteome;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9D291}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,418 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |