| IED ID | IndEnz0002004600 |
| Enzyme Type ID | protease004600 |
| Protein Name |
Deubiquitinase DESI2 EC 3.4.19.12 Desumoylating isopeptidase 2 DeSI-2 PPPDE peptidase domain-containing protein 1 Protein FAM152A |
| Gene Name | desi2 fam152a pppde1 |
| Organism | Xenopus laevis (African clawed frog) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) |
| Enzyme Sequence | MANQPIILNVYDMYWINEYTSSLGIGVFHSGIQVYGREFAYGGHPYPFSGVFEISPGDSTELGDTFKFKEAIALGSTDFTENDIEKIIEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWVNRLAYFSTCVPFLQSCLPKEWLTPAALQSSISQELQDELEEAEDAAASASTSTTAMPRPGRHTKL |
| Enzyme Length | 192 |
| Uniprot Accession Number | Q5PQ09 |
| Absorption | |
| Active Site | ACT_SITE 29; /evidence="ECO:0000255|PROSITE-ProRule:PRU01205"; ACT_SITE 107; /evidence="ECO:0000250|UniProtKB:Q9BSY9, ECO:0000255|PROSITE-ProRule:PRU01205" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:Q9BSY9}; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Has deubiquitinating activity towards 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. {ECO:0000250|UniProtKB:Q9BSY9}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (1); Region (1) |
| Keywords | Cytoplasm;Hydrolase;Protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9D291}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,415 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |