| IED ID | IndEnz0002004602 |
| Enzyme Type ID | protease004602 |
| Protein Name |
T-cell-specific surface glycoprotein CD28 CD antigen CD28 |
| Gene Name | Cd28 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MTLRLLFLALSFFSVQVTENKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPKLFWPLVVVAGVLLCYGLLVTVTLCIIWTNSRRNRLLQSDYMNMTPRRLGPTRKHYQPYAPARDFAAYRP |
| Enzyme Length | 218 |
| Uniprot Accession Number | P31042 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. {ECO:0000250|UniProtKB:P10747}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (1); Glycosylation (4); Modified residue (3); Signal peptide (1); Topological domain (2); Transmembrane (1) |
| Keywords | Disulfide bond;Glycoprotein;Immunoglobulin domain;Membrane;Phosphoprotein;Reference proteome;Signal;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein. |
| Modified Residue | MOD_RES 187; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P10747; MOD_RES 189; /note=Phosphotyrosine; /evidence=ECO:0000250|UniProtKB:P10747; MOD_RES 207; /note=Phosphotyrosine; /evidence=ECO:0000250|UniProtKB:P10747 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10458478; 12750179; 12864982; 15280538; 16061730; 18357346; 18601859; 19907173; 7730618; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,170 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |