Detail Information for IndEnz0002004612
IED ID IndEnz0002004612
Enzyme Type ID protease004612
Protein Name Desert hedgehog protein
DHH
Fragment
Gene Name dhh
Organism Danio rerio (Zebrafish) (Brachydanio rerio)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Danionidae Danioninae Danio Danio rerio (Zebrafish) (Brachydanio rerio)
Enzyme Sequence QRCKDCLYKLAIAVMNQWPGVRLRVTEAWDEDGHHPPGSLHYEGRAVDITTSDRDTKKYGLLAQLAVEAGFDWVHYESKYHVHCSVKA
Enzyme Length 88
Uniprot Accession Number P79729
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Intercellular signal essential for a variety of patterning events during development. {ECO:0000250}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Metal binding (8); Non-terminal residue (2); Sequence conflict (7)
Keywords Autocatalytic cleavage;Calcium;Cell membrane;Developmental protein;Hydrolase;Membrane;Metal-binding;Protease;Reference proteome;Secreted;Zinc
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}. Secreted, extracellular space {ECO:0000250}. Note=Desert hedgehog protein N-product: Cell membrane; Lipid-anchor; Extracellular side. The N-terminal peptide remains associated with the cell surface. Desert hedgehog protein C-product: Secreted, extracellular space. The C-terminal peptide diffuses from the cell. {ECO:0000250}.
Modified Residue
Post Translational Modification PTM: The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (N-product). This covalent modification appears to play an essential role in restricting the spatial distribution of the protein activity to the cell surface. The N-product is the active species in both local and long-range signaling, whereas the C-product has no signaling activity (By similarity). {ECO:0000250}.
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 16292774;
Motif
Gene Encoded By
Mass 10,069
Kinetics
Metal Binding METAL 26; /note=Calcium 1; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:O43323; METAL 27; /note=Calcium 1; /evidence=ECO:0000250|UniProtKB:O43323; METAL 27; /note=Calcium 2; /evidence=ECO:0000250|UniProtKB:O43323; METAL 30; /note=Calcium 2; /evidence=ECO:0000250|UniProtKB:O43323; METAL 32; /note=Calcium 2; /evidence=ECO:0000250|UniProtKB:O43323; METAL 41; /note=Zinc; /evidence=ECO:0000250|UniProtKB:O43323; METAL 48; /note=Zinc; /evidence=ECO:0000250|UniProtKB:O43323; METAL 83; /note=Zinc; /evidence=ECO:0000250|UniProtKB:O43323
Rhea ID
Cross Reference Brenda