IED ID | IndEnz0002004612 |
Enzyme Type ID | protease004612 |
Protein Name |
Desert hedgehog protein DHH Fragment |
Gene Name | dhh |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Danionidae Danioninae Danio Danio rerio (Zebrafish) (Brachydanio rerio) |
Enzyme Sequence | QRCKDCLYKLAIAVMNQWPGVRLRVTEAWDEDGHHPPGSLHYEGRAVDITTSDRDTKKYGLLAQLAVEAGFDWVHYESKYHVHCSVKA |
Enzyme Length | 88 |
Uniprot Accession Number | P79729 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Intercellular signal essential for a variety of patterning events during development. {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Metal binding (8); Non-terminal residue (2); Sequence conflict (7) |
Keywords | Autocatalytic cleavage;Calcium;Cell membrane;Developmental protein;Hydrolase;Membrane;Metal-binding;Protease;Reference proteome;Secreted;Zinc |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}. Secreted, extracellular space {ECO:0000250}. Note=Desert hedgehog protein N-product: Cell membrane; Lipid-anchor; Extracellular side. The N-terminal peptide remains associated with the cell surface. Desert hedgehog protein C-product: Secreted, extracellular space. The C-terminal peptide diffuses from the cell. {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | PTM: The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (N-product). This covalent modification appears to play an essential role in restricting the spatial distribution of the protein activity to the cell surface. The N-product is the active species in both local and long-range signaling, whereas the C-product has no signaling activity (By similarity). {ECO:0000250}. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 16292774; |
Motif | |
Gene Encoded By | |
Mass | 10,069 |
Kinetics | |
Metal Binding | METAL 26; /note=Calcium 1; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:O43323; METAL 27; /note=Calcium 1; /evidence=ECO:0000250|UniProtKB:O43323; METAL 27; /note=Calcium 2; /evidence=ECO:0000250|UniProtKB:O43323; METAL 30; /note=Calcium 2; /evidence=ECO:0000250|UniProtKB:O43323; METAL 32; /note=Calcium 2; /evidence=ECO:0000250|UniProtKB:O43323; METAL 41; /note=Zinc; /evidence=ECO:0000250|UniProtKB:O43323; METAL 48; /note=Zinc; /evidence=ECO:0000250|UniProtKB:O43323; METAL 83; /note=Zinc; /evidence=ECO:0000250|UniProtKB:O43323 |
Rhea ID | |
Cross Reference Brenda |