IED ID | IndEnz0002004615 |
Enzyme Type ID | protease004615 |
Protein Name |
Cysteine protease inhibitor 6 PCPI-6 Pcpi6 Fragment |
Gene Name | |
Organism | Solanum tuberosum (Potato) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) |
Enzyme Sequence | LNSPNAVLQHMSIPQFLGKGTPVVFVRKSESDYGDVVRVMTGVYIKFFFKTSKLCVDETVWKVNDEELVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCRSHLGCKNIGGNFKNGYPRLAAVDDDKDFIPFVFIKA |
Enzyme Length | 140 |
Uniprot Accession Number | O24386 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Inhibitor of cysteine proteases. May protect the plant by inhibiting proteases of invading organisms. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (1); Non-terminal residue (1) |
Keywords | Disulfide bond;Protease inhibitor;Reference proteome;Thiol protease inhibitor;Vacuole |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 15,745 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |